Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSU79274 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HSU79274 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HSU79274 Polyclonal specifically detects HSU79274 in Human samples. It is validated for Western Blot.Specifications
HSU79274 | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
chromosome 12 open reading frame 24, HSU79274, hypothetical protein LOC29902, protein predicted by clone 23733 | |
FAM216A | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8WUB2 | |
29902 | |
Synthetic peptides corresponding to C12ORF24 The peptide sequence was selected from the N terminal of C12ORF24. Peptide sequence AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title