Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579419

Invitrogen™ HTRA1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579419
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579419 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579419 Supplier Invitrogen™ Supplier No. PA579419
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell, rat heart tissue, mouse heart tissue. IHC: human rectal cancer tissue.

HtrA1, a 51KDa protein, is a member of highly conserved mammalian HtrA serine protease family. It is a human homolog of bacterial HtrA and consists of a secretory signal sequence, an IGFBP-binding domain and a Kazal-type serine-protease inhibitor domain at the N-terminus and a highly conserved trypsin-like serine/protease domain and a PDZ domain at the C-terminus. It plays a major role in the regulation of cell growth. HtrA1 inhibits signaling mediated by TGF-beta family members and regulates many physiological processes. HtrA1 is up-regulated in placenta during pregnancy and plays an important role in implantation and placental physiology. It regulates the availability of IGFs by cleaving IGF-binding proteins. It acts as a tumor suppressor and is down-regulated in ovarian cancers and melanomas. Its role has been implicated in osteoarthritis suggesting a therapeutic intervention. Northern blot analysis detected high expression in placenta.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HTRA1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene HTRA1
Gene Accession No. Q92743, Q9QZK5, Q9R118
Gene Alias AI429470; ARMD7; CADASIL2; CARASIL; High-temperature requirement A serine peptidase 1; HTRA; HtrA serine peptidase 1; Htra1; IGF binding; IGFBP5-protease; insulin-like growth factor binding protein 5 protease; L56; ORF480; protease serine 11; protease, serine, 11; protease, serine, 11 (IGF binding); PRSS11; RSPP11; serine protease; serine protease 11; Serine protease HTRA1; similar to bacterial htrA and degP
Gene Symbols HTRA1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56213, 5654, 65164
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.