Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
htrA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16269020UL
Description
htrA4 Polyclonal specifically detects htrA4 in Human samples. It is validated for Western Blot.Specifications
htrA4 | |
Polyclonal | |
Western Blot | |
P83105 | |
HTRA4 | |
Synthetic peptides corresponding to HTRA4(HtrA serine peptidase 4) The peptide sequence was selected form the middle region of HTRA4. Peptide sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 3.4.21, EC 3.4.21.-, EC 3.4.21.108, FLJ90724, HtrA serine peptidase 4, probable serine protease HTRA4 | |
Rabbit | |
Affinity Purified | |
RUO | |
203100 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction