Invitrogen™ HuD Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579199

Catalog No. PIPA579199

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue, U87-MG whole cell. IHC: mouse brain tissue, rat brain tissue, human meningeoma tissue.

HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Additionally, HuD is important in neurons during brain development and plasticity.

Specifications

• Antigen: HuD
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ELAVL4
• Gene Alias: Elav; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); ELAV like neuron-specific RNA binding protein 4; ELAVL4; ELAV-like protein 4; Hu antigen D; HU-antigen D; Hud; Paraneoplastic encephalomyelitis antigen HuD; PNEM; RGD1561943; r-HuD; RNA-binding protein HUD3
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 15572, 1996, 432358
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O09032, P26378, Q61701
• Gene Symbols: ELAVL4
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG