Invitrogen™ Human ACOT9 (aa 202-289) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57310 (PA5-57310. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acyl-CoA thioesterases (ACOTs) are a group of enzymes that catalyze the hydrolysis of acyl-CoA to form coenzyme A (CoA) and a free fatty acid. Through their catalytic activity, ACOTs are able to regulate the level of fatty acids and acyl-CoAs within the cell. ACOT9 (acyl-CoA thioesterase 9), also known as ACATE2, MT-ACT48 (mitochondrial acyl-CoA thioesterase of 48 kDa) or CGI-16, is a 406 amino acid member of the acyl-CoA hydrolase protein family. ACOT9 contains a C-terminal 80-amino acid domain that is conserved from mouse to human, suggesting that the C-terminus may confer the catalytic activity of ACOT9. The gene encoding ACOT9 is located on chromosome X and the expressed ACOT9 protein is localized to the mitochondrion.

Specifications

• Accession Number: Q9Y305
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23597
• Name: Human ACOT9 (aa 202-289) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610041P13Rik; Acate2; ACOT9; Acyl coenzyme A thioester hydrolase 2; acyl-CoA thioester hydrolase 9; Acyl-CoA thioesterase 9; acyl-Coenzyme A thioesterase 2, mitochondrial; acyl-coenzyme A thioesterase 9, mitochondrial; C76421; CGI-16; Mitochondrial 48 kDa acyl-CoA thioester hydrolase 1; mitochondrial acyl-CoA thioesterase; MTACT48; MT-ACT48; mt-ACT48.1; MTE-2; p48; Protein U8; U8
• Common Name: ACOT9
• Gene Symbol: ACOT9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining