Invitrogen™ Human AKAP7 (aa 188-268) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55534 (PA5-55534. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the A-kinase anchoring protein family, a group of functionally related proteins that bind to a regulatory subunit of cAMP-dependent protein kinase A and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Specifications

• Accession Number: O43687, Q9P0M2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9465
• Name: Human AKAP7 (aa 188-268) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430401D08; A kinase (PRKA) anchor protein 7; AI662165; AKAP 18; AKAP 9; AKAP15; AKAP18; AKAP-18; AKAP-18 {ECO:0000250; AKAP18d; Akap7; akap7 {ECO:0000312; AKAP-7 isoform alpha; AKAP-7 isoform gamma; AKAP-7 isoforms alpha and beta; AKAP-7 isoforms delta and gamma; A-kinase anchor protein 18; A-kinase anchor protein 18 {ECO:0000250; A-kinase anchor protein 18 kDa; A-kinase anchor protein 7; A-kinase anchor protein 7 isoform alpha; A-kinase anchor protein 7 isoform gamma; A-kinase anchor protein 7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms delta and gamma; A-kinase anchor protein 9 kDa; A-kinase anchoring protein 18 ,isoform delta; A-kinase anchoring protein 7; BB170514; PRKA7 isoform alpha; PRKA7 isoform gamma; PRKA7 isoforms alpha/beta; PRKA7 isoforms delta and gamma; protein kinase A anchoring protein 7; protein kinase A-anchoring protein 7 isoform alpha; Protein kinase A-anchoring protein 7 isoform gamma; Protein kinase A-anchoring protein 7 isoforms alpha/beta; Protein kinase A-anchoring protein 7 isoforms delta and gamma; RGD:1303071}; UniProtKB:F8VQ58}
• Common Name: AKAP7
• Gene Symbol: AKAP7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining