Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95321

Invitrogen™ Human alpha-1d Adrenoceptor (aa 502-569) Control Fragment Recombinant Protein

Catalog No. RP95321
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1D-adrenergic receptor. Similar to alpha-1B-adrenergic receptor gene, this gene comprises 2 exons and a single intron that interrupts the coding region.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P25100
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 146
Name Human alpha-1 d Adrenoceptor (aa 502-569) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [a]1 d; ADA1D; Adra1; Adra-1; Adra1a; Adra1d; ADRA1R; Adrd1; adrenergic receptor delta1; adrenergic receptor, alpha 1 d; adrenergic, alpha -1 D-, receptor; adrenergic, alpha-1 A-, receptor; adrenergic, alpha-1 D-, receptor; adrenoceptor alpha 1 D; alpha 1 D-adrenoceptor; alpha 1 D-adrenoreceptor; ALPHA1; alpha-1 A adrenergic receptor; Alpha-1 D adrenergic receptor; alpha-1 D adrenoceptor; Alpha-1 D adrenoreceptor; alpha-1 D-adrenergic receptor; alpha1D-AR; Alpha1delta-AR; alpha-adrenergic receptor 1 A; DAR; dJ779E11.2; Gpcr8; RA42; Spr8
Common Name alpha-1 d Adrenoceptor
Gene Symbol Adra1d
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEGATCQAYELADYSNLRE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.