Invitrogen™ Human ALPK1 (aa 1075-1155) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55621 (PA5-55621. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Unlike most eukaryotic kinases, alpha kinases, such as LAK, recognize phosphorylation sites in which the surrounding peptides have an alpha-helical conformation.

Specifications

• Accession Number: Q96QP1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80216
• Name: Human ALPK1 (aa 1075-1155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430410J10Rik; alpha kinase 1; alpha-kinase 1; alpha-protein kinase 1; Alpk1; Chromosome 4 kinase; KIAA1527; LAK; lymphocyte alpha-kinase; lymphocyte alpha-protein kinase; RGD1304613
• Common Name: ALPK1
• Gene Symbol: ALPK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining