Invitrogen™ Human APEH (aa 415-501) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83098 (PA5-83098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. APEH gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. The protein can play an important role in destroying oxidatively damaged proteins in living cells.

Specifications

• Accession Number: P13798
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 327
• Name: Human APEH (aa 415-501) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AARE; ACPH; Acylamino-acid-releasing enzyme; acylamino-acid-releasing enzyme-like; acylaminoacyl-peptidase; acylaminoacyl-peptide hydrolase; acylpeptide hydrolase; Acyl-peptide hydrolase; Apeh; APH; cb5; D3F15S2; D3S48E; DNF15S2; LOW QUALITY PROTEIN: acylamino-acid-releasing enzyme; acylamino-acid-releasing enzyme; MGC2178; N-acylaminoacyl peptide hydrolase; N-acylaminoacyl-peptide hydrolase; OPH; Oxidized protein hydrolase; sb:cb5; wu:fi37d02
• Common Name: APEH
• Gene Symbol: APEH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining