Invitrogen™ Human ARGBP2 (aa 769-857) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57801 (PA5-57801. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Arg and c-Abl represent the mammalian members of the Abelson family of non-receptor protein-tyrosine kinases. They interact with the Arg/Abl binding proteins via the SH3 domains present in the carboxy end of the latter group of proteins. ARGBP2 is the sorbin and SH3 domain containing 2 protein. It has three C-terminal SH3 domains and an N-terminal sorbin homology(SoHo) domain that interacts with lipid raft proteins. The subcellular localization of this protein in epithelial and cardiac muscle cells suggests that it functions as an adapter protein to assemble signaling complexes in stress fibers, and that it is a potential link between Abl family kinases and the actin cytoskeleton.

Specifications

• Accession Number: O94875
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8470
• Name: Human ARGBP2 (aa 769-857) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010203O03Rik; 9430041O17Rik; A530071H08; Arg binding protein 2; Arg/Abl-interacting protein 2; Arg/Abl-interacting protein ArgBP2; arg-binding protein 2; ARGBP2; KIAA0777; leucine-rich repeat extensin-like protein 5; mKIAA0777; nArgBP2; Neural ArgBP2; PRO0618; Sorbin; sorbin and SH3 domain containing 2; sorbin and SH3 domain-containing protein 2; SORBS2
• Common Name: ARGBP2
• Gene Symbol: SORBS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining