Abnova™ Human ATOX1 (NP_004036.1) Full-length Recombinant Protein expressed in yeast

Description

Used for SDS-PAGE

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq]

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Specifications

• Accession Number: NP_004036.1
• For Use With (Application): SDS-PAGE
• Formulation: In 50mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30mM Glutathione, 0.5% TritonX-100, 1mM dithiothreitol)
• Gene ID (Entrez): 475
• Molecular Weight (g/mol): 7.39kDa
• Name: ATOX1 (Human) Recombinant Protein
• Preparation Method: Yeast expression system
• Purification Method: Affinity Purification
• Quantity: 100 μg
• Storage Requirements: Store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ATX1/HAH1/MGC138453/MGC138455
• Common Name: ATOX1
• Gene Symbol: ATOX1
• Species: Yeast
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Yeast expression system
• Form: Liquid
• Purity or Quality Grade: 0.9