Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human ATOX1 (NP_004036.1) Full-length Recombinant Protein expressed in yeast

Used for SDS-PAGE

Manufacturer:  Abnova™ P3737

Catalog No. 89-935-984


Add to cart

Description

Description

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq]

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Specifications

Specifications

Yeast expression system
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
In 50mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30mM Glutathione, 0.5% TritonX-100, 1mM dithiothreitol)
7.39kDa
Yeast expression system
0.9
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
ATX1/HAH1/MGC138453/MGC138455
ATOX1
Yes
NP_004036.1
Liquid
475
ATOX1 (Human) Recombinant Protein
Affinity Purification
100 ug
RUO
ATOX1
Yeast
None
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit