Invitrogen™ Human BAD (aa 12-87) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83003 (PA5-83003. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by BAD is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.

Specifications

• Accession Number: Q92934
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 572
• Name: Human BAD (aa 12-87) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI325008; BAD; Bbc2; Bbc6; Bcl2 antagonist of cell death; BCL2 associated agonist of cell death; bcl-2 associated death agonist; Bcl2-antagonist of cell death; BCL2-antagonist of cell death protein; bcl2-associated agonist of cell death; bcl2-associated death promoter; bcl-2-binding component 6; BCL2-binding component 6; BCL2-binding protein; BCL2L8; bcl2-L-8; Bcl-2-like protein 8; BCL-X/BCL-2 binding protein; bcl-XL/Bcl-2-associated death promoter; hypothetical protein LOC615013; OTTMUSP00000017561; OTTMUSP00000022400
• Common Name: BAD
• Gene Symbol: BAD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining