Invitrogen™ Human c-Abl (aa 729-806) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ABL1 proto-oncogene encodes a cytoplasmic and nuclear protein tyrosine kinase that has been implicated in processes of cell differentiation, cell division, cell adhesion, and stress response. Activity of c-Abl protein is negatively regulated by its SH3 domain, and deletion of the SH3 domain turns c-Abl into an oncogene. The DNA-binding activity of the ubiquitously expressed ABL1 tyrosine kinase is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function for c-Abl. In chronic myelogenous leukemia and a subset of acute lymphoblastic leukemias, the c-Abl proto oncogene undergoes a (9;22) chromosomal translocation producing a novel rearranged chromosome (the Philadelphia chromosome). As the result of the fusion of c-Abl sequences from chromosome 9 to the Bcr gene on chromosome 22. The c-Abl oncogene was initially identified as the viral transforming gene of Abelson murine leukemia virus (A-MuLV). c-ABL potentially regulates DNA repair by activating the proapoptotic pathway when the DNA damage is too severe to be repaired.

Specifications

• Accession Number: P00519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25
• Name: Human c-Abl (aa 729-806) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Abelson murine leukemia oncogene; Abelson murine leukemia viral (v-abl) oncogene homolog 1; abelson murine leukemia viral oncogene homolog 1; Abelson tyrosine-protein kinase 1; Abl; Abl 1 antib; ABL proto-oncogene 1, non-receptor tyrosine kinase; Abl1; ABL2; ABLL; AI325092; ARG; B30; bcr/abl; bcr/c-abl oncogene protein; c-ABL; c-abl oncogene 1, non-receptor tyrosine kinase; c-abl oncogene 1, receptor tyrosine kinase; c-ABL1; E430008G22Rik; JTK7; p150; Proto-oncogene c-Abl; proto-oncogene tyrosine-protein kinase ABL1; RP11-83J21.1; Tyrosine kinase ARG; tyrosine-protein kinase ABL1; v-abl; v-abl Abelson murine leukemia oncogene 1; v-abl Abelson murine leukemia viral oncogene 1; v-abl Abelson murine leukemia viral oncogene homolog 1
• Common Name: c-Abl
• Gene Symbol: ABL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining