Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95275

Invitrogen™ Human c-Cbl (aa 809-905) Control Fragment Recombinant Protein

Catalog No. RP95275
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82992 (PA5-82992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cbl proteins are a family of ubiquitin protein ligases (E3s) that negatively regulate signaling by targeting activated tyrosine kinases for degradation. Cbl- c is the most recently cloned member of the Cbl proteins and is expressed only in epithelial cells (the other Cbl proteins are ubiquitously expressed). Cbl-c, like the other mammalian Cbl proteins, can ubiquitinate the activated EGFR and target it for degradation. Through interactions with proteins containing SRC homology-2 (SH2) and SH3 domains, CBL proteins modulate downstream cell signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22681
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 867
Name Human c-Cbl (aa 809-905) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4732447J05Rik; Cas-Br-M (murine) ecotropic retroviral transforming sequence; Casitas B-lineage lymphoma; casitas B-lineage lymphoma proto-oncogene; CBL; Cbl proto-oncogene; Cbl proto-oncogene, E3 ubiquitin protein ligase; CBL2; Cbl-2; CBL-3; CBLC; c-Cbl; E3 ubiquitin-protein ligase CBL; FRA11B; fragile site, folic acid type, rare, fra(11)(q23.3); NSLL; oncogene CBL2; proto-oncogene c-Cbl; RGD1561386; RING finger protein 55; RING-type E3 ubiquitin transferase CBL; RNF55; RNF57; signal transduction protein CBL
Common Name c-Cbl
Gene Symbol Cbl
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.