Invitrogen™ Human C17orf99 (aa 182-265) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56224 (PA5-56224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable B cell-associated cytokine that plays a role in the regulation of humoral immune responses. Involved in lymphocyte B cell development and immunoglobulin/IgA production.

Specifications

• Accession Number: Q6UX52
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100141515
• Name: Human C17orf99 (aa 182-265) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C17orf99; chromosome 17 open reading frame 99; GLPG464; IL40; IL-40; Interleukin-40; Protein IL-40; uncharacterized protein C17orf99; UNQ464; UNQ464/PRO809
• Common Name: C17orf99
• Gene Symbol: C17orf99
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining