Invitrogen™ Human C4BPA Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81954 (PA5-81954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

There are 3 variants of Complement component 4 binding protein (C4bp), which is composed of alpha and beta chains. The predominant form is a 570 kDa complex of 7 alpha chains and 1 beta chain. The other complexes formed are a 530 kDa homoheptamer of alpha chains or a 500 kDa complex of 6 alpha chains and 1 beta chain. C4bp regulates the activation of the classical complement pathway. It is a cofactor to the C3b/C4b inactivator, crucial to the proteolytic cleavage of C4b and important in cleavage of C3b. C4bp also regulates the C4bC2a complex (C3 convertase), accelerating its degradation by dissociating the complement fragment C2a. Both the C4bp alpha and beta chains interact with anticoagulant protein S and C4bp alpha binds protein S. C4bp is expressed in the blood serum.

Specifications

• Accession Number: P04003
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 722
• Name: Human C4BPA Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI195242; C4b-binding protein; C4b-binding protein alpha chain; C4bp; C4bpa; complement component 4 binding protein; complement component 4 binding protein alpha; complement component 4 binding protein, alpha; proline-rich protein; PRP; RP11-164O23.4
• Common Name: C4BPA
• Gene Symbol: C4BPA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLRGSSVIHCDADSKWNPSPPACEPNSCTNLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining