Invitrogen™ Human C5orf42 (aa 2717-2793) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57810 (PA5-57810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9H799
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65250
• Name: Human C5orf42 (aa 2717-2793) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C5orf42; chromosome 5 open reading frame 42; Ciliogenesis and planar polarity effector 1; CPLANE1; Hug; JBTS17; OFD6; Protein JBTS17; Transmembrane protein ENSP00000382582; uncharacterized protein C5orf42
• Common Name: C5orf42
• Gene Symbol: C5orf42
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IAENIEQDFPKPEMLDLHCDKIGPVDHIEFSSGPEFKKTLASKTISISEEVRFLTHMDEEDQSDKKETSEPEFSITE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining