Invitrogen™ Human CACNB2 (aa 563-642) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57230 (PA5-57230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The expression of multiple classes of voltage dependent calcium channels (VDCCs) allows neurons to tailor calcium signaling to functionally discrete cellular regions. Although N-Type VDCCs exist before birth which is consistent with a role in migration, most N-Type VDCCs subunit expression is postnatal and is important in the genesis of synaptic transmission in discrete hippocampal fields.

Specifications

• Accession Number: Q08289
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 783
• Name: Human CACNB2 (aa 563-642) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW060387; brain calcium channel beta-subunit CaB2c (splice variant of the gene CaB2); CAB1; CAB2; Cacnb2; CACNLB1; Cacnlb2; Calcium channel voltage-dependent subunit beta 2; calcium channel, voltage-dependent, beta 2 subunit; calcium voltage-gated channel auxiliary subunit beta 2; cardiac calcium channel beta subunit; cardiac calcium channel beta-subunit CaB2a (splice variant of the gene CaB2; cardiac calcium channel beta-subunit CaB2b (splice variant of the gene CaB2); CAVB2; Cavbeta2; Cchb2; CCHLB1; lambert-Eaton myasthenic syndrome antigen B; L-type calcium channel beta subunit; L-type voltage-dependent calcium channel beta-2 subunit; MGC138502; MGC138504; MGC41896; myasthenic (Lambert-Eaton) syndrome antigen B; MYSB; voltage-dependent calcium channel beta2A subunit; voltage-dependent calcium channel beta2B subunit; voltage-dependent L-type calcium channel subunit beta-2; voltage-gated calcium channel beta2 subunit transcript variant X13
• Common Name: CACNB2
• Gene Symbol: Cacnb2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining