Invitrogen™ Human CD55 (aa 40-188) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82882 (PA5-82882. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD55 (decay-accelerating factor, DAF) is a GPI-anchored membrane glycoprotein that protects autologous cells from classical and alternative pathway of complement cascade. Bidirectional interactions between CD55 and CD97 are involved in T cell regulation and CD55 can regulate complement when bound to CD97. In tumors, CD55 promotes neoangiogenesis, tumorigenesis, invasiveness and evasion of apoptosis. CD55 is a 70 kDa glycoprotein (in erythrocytes) anchored in the membrane by glycosylphosphatidylinositol tail. In other cells, the apparent molecular weight is somewhat larger for CD55 and has a substantial content of O-glycans. CD55 binds to activated C4b or C3b complement fragments on the cell surface, preventing the assembly and accelerating the decay of both classical and alternative pathways. CD55 carries the Cromer related blood group antigens. Two alternatively spliced transcripts encoding CD55 have been identified, and the predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. CD55 has been studied to have a role in prostate cancer growth and survival.

Specifications

• Accession Number: P08174
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1604
• Name: Human CD55 (aa 40-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD55; CD55 antigen; CD55 molecule (Cromer blood group); CD55 molecule, decay accelerating factor for complement; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay-accelerating factor; complement decay-accelerating factor, GPI-anchored; complement-glycosylphosphatidylinositol; CR; CROM; Cromer blood group; Daf; Daf1; DAF-GPI; decay accelarating factor 1; decay accelerating factor 1; decay accelerating factor GPI-form; decay-accelarating factor; glycosylphophatidylinositol-anchored form; GPI anchor addition signal; GPI-DAF; RP11-357P18.1; TC
• Common Name: CD55
• Gene Symbol: CD55
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining