Invitrogen™ Human CD90 (aa 22-143) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82115 (PA5-82115. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD90 (Thy 1) antigen is a GPI linked glycoprotein member of the Immunoglobulin super family. CD90 is expressed in murine T cells, thymocytes, neural cells, Kupffer's cells and fibroblasts. CD90 may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. CD90 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Structural study of CD90 led to the foundation of the Immunoglobulin superfamily, of which it is the smallest member, and led to the first biochemical description and characterization of a vertebrate GPI anchor. Diseases associated with CD90 dysfunction include nasopharyngeal carcinoma and thymoma.

Specifications

• Accession Number: P04216
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7070
• Name: Human CD90 (aa 22-143) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CD7; CD90; CDw90; FLJ33325; membrane glycoprotein; T25; Thy 1.2; THY1; Thy-1; Thy-1 antigen; Thy-1 cell surface antigen; thy-1 glycoprotein; thy-1 membrane glycoprotein; Thy-1 protein; Thy-1 T-cell antigen; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta; Thymus cell surface antigen
• Common Name: CD90 (Thy1)
• Gene Symbol: Thy1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining