Invitrogen™ Human CLNS1A (aa 2-98) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56906 (PA5-56906. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via methylation of histones, rendering chromatin heritably changed in its expressibility. Involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator for PPARG and enhances its adipocyte differentiation-inducing activity; the function seems to involve differential recruitment of acetylated and methylated histone H3.

Specifications

• Accession Number: P54105
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1207
• Name: Human CLNS1A (aa 2-98) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610036D06Rik; 2610100O04Rik; ARPC1A; chloride channel; chloride channel current inducer; chloride channel regulator; chloride channel regulatory protein; chloride channel, nucleotide sensitive 1 A; chloride channel, nucleotide-sensitive, 1 A; chloride conductance regulatory protein ICln; Chloride ion current inducer protein; chloride nucleotide-sensitive channel 1 A; ClCI; Clcni; Clns 1 A; CLNS1A; CLNS1B; I(Cln); icln; icln protein; methylosome subunit pICln; pIcIn; pICln; Rcl1; Reticulocyte pICln; reticulocyte protein ICln; SOP2L; SOP2-like protein; swelling dependent chloride channel; swelling-induced chloride conductance regulatory protein; swelling-induced chloride conductance regulatory protein pIcIn
• Common Name: CLNS1A
• Gene Symbol: CLNS1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining