Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93423

Invitrogen™ Human CNP (aa 171-243) Control Fragment Recombinant Protein

Catalog No. RP93423
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNP (2',3'-Cyclic Nucleotide 3' Phosphodiesterase) is a Protein Coding gene. Diseases associated with CNP include Leukodystrophy, Hypomyelinating, 20 and Myopia 2, Autosomal Dominant. Among its related pathways are MECP2 and associated Rett syndrome and Glial cell differentiation. Gene Ontology (GO) annotations related to this gene include RNA binding and cyclic nucleotide binding.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09543
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1267
Name Human CNP (aa 171-243) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2', 3' cyclic nucleotide 3' phosphohydrolase; 2',3'-cyclic nucleotide 3' phosphodiesterase; 2',3'-cyclic-nucleotide 3'-phosphodiesterase; CNP; CNP1; CNP2; CNP-22; CNP-29; CNP-53; CNPase; C-type natriuretic peptide; C-type natriuretic peptide/factor; HLD20; lbab; natriuretic peptide C; natriuretic peptide precursor C; natriuretic peptide precursor type C; natriuretic peptide type C; NPPC; snake venom metalloprotease inhibitor 02D01-like; SVSP15
Common Name CNP
Gene Symbol CNP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.