Invitrogen™ Human CNTNAP4 (aa 1198-1239) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63433 (PA5-63433. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Presynaptic protein involved in both dopaminergic synaptic transmission and GABAergic system, thereby participating in the structural maturation of inhibitory interneuron synapses. Involved in the dopaminergic synaptic transmission by attenuating dopamine release through a presynaptic mechanism. Also participates in the GABAergic system.

Specifications

• Accession Number: Q9C0A0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85445
• Name: Human CNTNAP4 (aa 1198-1239) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Caspr4; cell recognition molecule Caspr4; cell recognition protein CASPR4; Cntnap4; contactin associated protein 4; contactin associated protein like 4; contactin associated protein-like 4; contactin-associated protein-like 4; E130114F09Rik; KIAA1763
• Common Name: CNTNAP4
• Gene Symbol: CNTNAP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining