Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Human Coronavirus Spike S1 Antibody, Novus Biologicals™

Human Coronavirus Spike S1 Antibody, Novus Biologicals™
SDP

Catalog No. NB557168 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB557168 100 μL
NB557569 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB557168 Supplier Novus Biologicals Supplier No. NBP337887100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Human Coronavirus Spike S1 Polyclonal antibody specifically detects Human Coronavirus Spike S1 in HCoV-229E samples. It is validated for ELISA,Western Blot

Specifications

Antigen Human Coronavirus Spike S1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).,, Sequence:, TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Target Species HCoV-229E
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.