Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89940685

Abnova™ Human CSF1 (P09603, 33 a.a. - 181 a.a.) Partial Recombinant Protein expressed in baculovirus infected

Catalog No. 89940685 Shop All Abnova Corporation Products
Click to view available options
Quantity:
10 μg

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ

Specifications

Accession Number P09603
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 1435
Molecular Weight (g/mol) 42kDa
Name CSF1 (Human) Recombinant Protein
Preparation Method Bombyx Mori expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 10 μg
Immunogen EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias MCSF/MGC31930
Common Name CSF1
Gene Symbol CSF1
Biological Activity The ED50 was determined by the dose-dependent stimulation of the proliferation of of M-NFS-60 cells is <1.0ng/mL, corresponding to a specific activity of >1 x 106 units/mg.
Species Baculovirus
Recombinant Recombinant
Protein Tag None
Expression System Bombyx Mori expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.