Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CXCR7 (aa 3-45) Control Fragment Recombinant Protein

Catalog No. RP95159
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P25106
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57007
Name Human CXCR7 (aa 3-45) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACKR3; Atypical chemokine receptor 3; AW541270; C Cmotif chemokine; C x C motif chemokine; CC motif chemokine; CCmotif chemokine; chemokine; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1; Cmkor1; CXC; C-X-C chemokine receptor type 7; CXC motif chemokine; CXCR7; CXC-R7; CXCR-7; G protein-coupled receptor; GPR159; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC1; RDC-1
Common Name CXCR7
Gene Symbol Ackr3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.