Invitrogen™ Human CXCR7 (aa 3-45) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.

Specifications

• Accession Number: P25106
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57007
• Name: Human CXCR7 (aa 3-45) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACKR3; Atypical chemokine receptor 3; AW541270; C Cmotif chemokine; C x C motif chemokine; CC motif chemokine; CCmotif chemokine; chemokine; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1; Cmkor1; CXC; C-X-C chemokine receptor type 7; CXC motif chemokine; CXCR7; CXC-R7; CXCR-7; G protein-coupled receptor; GPR159; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC1; RDC-1
• Common Name: CXCR7
• Gene Symbol: Ackr3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining