Invitrogen™ Human EEF1E1 (aa 7-98) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55722 (PA5-55722. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: O43324
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9521
• Name: Human EEF1E1 (aa 7-98) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110003A02Rik; AIMP3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Eef1e1; Elongation factor p18; eukaryotic translation elongation factor 1 epsilon 1; eukaryotic translation elongation factor 1 epsilon-1; Multisynthase complex auxiliary component p18; multisynthetase complex auxiliary component p18; P18; p18 component of aminoacyl-tRNA synthetase complex
• Common Name: EEF1E1
• Gene Symbol: EEF1E1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining