Invitrogen™ Human eIF4G3 (aa 1119-1211) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55208 (PA5-55208. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is thought to be part of the eIF4F protein complex, which is involved in mRNA cap recognition and transport of mRNAs to the ribosome. Interestingly, a microRNA (miR-520c-3p) has been found that negatively regulates synthesis of the encoded protein, and this leads to a global decrease in protein translation and cell proliferation. Therefore, this protein is a key component of the anti-tumor activity of miR-520c-3p.

Specifications

• Accession Number: O43432
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8672
• Name: Human eIF4G3 (aa 1119-1211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500002J22Rik; 4833436O05; 4930523M17Rik; eIF4G 3; eIF-4 G 3; Eif4g3; eIF-4-gamma 3; eIF-4-gamma II; eIF4GII; eukaryotic translation initiation factor 4 gamma 3; eukaryotic translation initiation factor 4 gamma, 3; G1-419-52; repro8; RP11-190H11.1
• Common Name: eIF4G3
• Gene Symbol: EIF4G3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EFDSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRESAKPEISAMSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining