Invitrogen™ Human eIF4H (aa 76-157) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83149 (PA5-83149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Specifications

• Accession Number: Q15056
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7458
• Name: Human eIF4H (aa 76-157) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU018978; D5Ertd355e; E430026L18Rik; Ef4h; EIF4H; eIF-4 H; Eukaryotic translation initiation factor 4 H; KIAA0038; mKIAA0038; WBSCR1; Williams-Beuren syndrome chromosomal region 1 protein; Williams-Beuren syndrome chromosomal region 1 protein homolog; Williams-Beuren syndrome chromosome region 1; Williams-Beuren syndrome chromosome region 1 homolog; WSCR1
• Common Name: eIF4H
• Gene Symbol: EIF4H
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining