Invitrogen™ Human ENC-2 (aa 175-288) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82832 (PA5-82832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL25 (ectoderm-neural cortex protein 2, ENC2) is a cytoplasmic protein that contains six Kelch regions and a single BTB (POZ) domain. KLHL25 is highly homologus to another Kelch-like protein, ENC1, and it is believed to operate in a manner similar to other Kelch-domain containing proteins. Kelch-domain repeat containing proteins often act as modifiers of Actin fibers. Expressed early in embryogenesis, ENC1 helps to mediate neuronal process formation. It also appears to have a role in neural crest cell differentiation. KLHL25 likely functions as a substrate specific adapter for protein ubiquitinating complexes. KLHL25 is expressed in most tissues with highest expression in brain and liver.

Specifications

• Accession Number: Q9H0H3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64410
• Name: Human ENC-2 (aa 175-288) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810402K13Rik; BC027373; BTB/POZ KELCH domain protein; ectodermal-neural cortex 2; ectoderm-neural cortex protein 2; ectoderm-neural cortex-1; Enc-1; ENC2; ENC-2; FLJ12587; FLJ45015; kelch like family member 25; kelch-like 25; kelch-like family member 25; kelch-like protein 25; KLHL25; RGD1310815
• Common Name: ENC-2
• Gene Symbol: KLHL25
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining