Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human ENC-2 (aa 175-288) Control Fragment Recombinant Protein

Catalog No. RP93633
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82832 (PA5-82832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KLHL25 (ectoderm-neural cortex protein 2, ENC2) is a cytoplasmic protein that contains six Kelch regions and a single BTB (POZ) domain. KLHL25 is highly homologus to another Kelch-like protein, ENC1, and it is believed to operate in a manner similar to other Kelch-domain containing proteins. Kelch-domain repeat containing proteins often act as modifiers of Actin fibers. Expressed early in embryogenesis, ENC1 helps to mediate neuronal process formation. It also appears to have a role in neural crest cell differentiation. KLHL25 likely functions as a substrate specific adapter for protein ubiquitinating complexes. KLHL25 is expressed in most tissues with highest expression in brain and liver.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H0H3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64410
Name Human ENC-2 (aa 175-288) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810402K13Rik; BC027373; BTB/POZ KELCH domain protein; ectodermal-neural cortex 2; ectoderm-neural cortex protein 2; ectoderm-neural cortex-1; Enc-1; ENC2; ENC-2; FLJ12587; FLJ45015; kelch like family member 25; kelch-like 25; kelch-like family member 25; kelch-like protein 25; KLHL25; RGD1310815
Common Name ENC-2
Gene Symbol KLHL25
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADERTKLIMDEALRCKTRILQNDGVVTSPCA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.