Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94701

Invitrogen™ Human FAM120B (aa 573-658) Control Fragment Recombinant Protein

Catalog No. RP94701
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57984 (PA5-57984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The transcription factor peroxisome proliferator-activated receptor -gamma (PPARg) plays essential roles in adipogenesis by regulating adipocyte-specific genes through association of various co-factors. One such co-factor, PGCC1 (also known as FAM120B), is widely expressed in adult tissues and throughout embryonic development. Overexpression of this protein in OP9 pre-adipocytes promoted their differentiation into adipocytes, and knockdown of PGCC1 expression through RNA interference blocked this process. PGCC1 is homologous to C9orf10 (also known as FAM120A) and has been mapped to chromosome Xp11.22. At least two isoforms of PGCC1 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96EK7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84498
Name Human FAM120B (aa 573-658) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4932442K08Rik; AW049283; AW413338; CCPG; Constitutive coactivator of peroxisome proliferator-activated receptor gamma; constitutive coactivator of PPARG; constitutive coactivator of PPAR-gamma; dJ894D12.1; f120b; FAM120B; family with sequence similarity 120, member B; family with sequence similarity 120 B; KIAA1838; mKIAA1838; PGCC1; PPARG constitutive coactivator 1; PPARgamma constitutive coactivator 1; Protein FAM120B; RGD1310304
Common Name FAM120B
Gene Symbol FAM120B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.