Invitrogen™ Human FAM129A (aa 548-645) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55934 (PA5-55934. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates phosphorylation of a number of proteins involved in translation regulation including EIF2A, EIF4EBP1 and RPS6KB1. May be involved in the endoplasmic reticulum stress response.

Specifications

• Accession Number: Q9BZQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116496
• Name: Human FAM129A (aa 548-645) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI256368; AU019833; C1orf24; Cell growth-inhibiting gene 39 protein; FAM129A; family with sequence similarity 129 member A; family with sequence similarity 129, member A; GIG39; NIBAN; niban apoptosis regulator 1; niban protein; Niban1; Protein FAM129A; Protein Niban; protein Niban 1; protein Niban 1; protein Niban
• Common Name: FAM129A
• Gene Symbol: FAM129A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARRASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining