Invitrogen™ Human FLAD1 (aa 130-211) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55874 (PA5-55874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLAD1 encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

Specifications

• Accession Number: Q8NFF5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80308
• Name: Human FLAD1 (aa 130-211) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930017E24Rik; fa92c06; FAD pyrophosphorylase; FAD synthase; FAD synthase region; FAD synthetase; FAD1; FAD1 flavin adenine dinucleotide synthetase homolog; Fad1, flavin adenine dinucleotide synthetase, homolog; FADS; FAD-synthetase; FLAD1; Flavin adenine dinucleotide synthase; flavin adenine dinucleotide synthetase; flavin adenine dinucleotide synthetase 1; FMN adenylyltransferase; hypothetical protein LOC506682; LSMFLAD; Molybdenum cofactor biosynthesis protein-like region; PP591; RFad1, flavin adenine dinucleotide synthetase, homolog (yeast); RP11-307C12.7; wu:fa92c06; zgc:91843
• Common Name: FLAD1
• Gene Symbol: FLAD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining