Invitrogen™ Human GABPB2 (aa 137-223) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GABPB2 (GA binding protein transcription factor, beta subunit 2) is a protein-coding gene. GO annotations related to this gene include protein homodimerization activity and transcription regulatory region DNA binding. An important paralog of this gene is ANKRD2.

Specifications

• Accession Number: Q8TAK5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126626
• Name: Human GABPB2 (aa 137-223) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810015F01Rik; 5830427M07; 9430006E19Rik; A430024B14Rik; AV050852; BABPB2; E4TF1; E4TF1-47; E4TF1-53; E4TF1B; GA binding protein transcription factor beta subunit 1; GA binding protein transcription factor beta subunit 1 transcript variant gamma-2; GA binding protein transcription factor beta subunit 2; GA binding protein transcription factor subunit beta 2; GA binding protein transcription factor, alpha subunit pseudogene; GA binding protein transcription factor, beta subunit 1; GA binding protein transcription factor, beta subunit 2; GA repeat binding protein, beta 2; GA-binding protein beta-2-1; GA-binding protein subunit beta-1; GA-binding protein subunit beta-2; GABP subunit beta-1; GABP subunit beta-2; GABP subunit beta-2-1; GABP2; GABPAP; GABPB; GABPB1; GABPB-1; Gabpb2; GABPB-2; Gabpb2-1; LOW QUALITY PROTEIN: GA-binding protein subunit beta-2; NRF2B1; NRF2B2; Nuclear respiratory factor 2; RGD1565234; RP11-68I18.1; Transcription factor E4TF1-47; transcription factor E4TF1-53
• Common Name: GABPB2
• Gene Symbol: Gabpb2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining