Invitrogen™ Human GRB10 (aa 437-515) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRB7, a SH2 domain protein, has a single SH2 domain at its C-terminal, a central region with similarity to Ras GAP, and a proline-rich N terminus. A related SH2 domain-containing protein, GRB10, exhibits a high degree of homology with GRB7. GRB10 undergoes serine but not tyrosine phosphorylation in response to EGF treatment, but appears to bind to the EGF receptor poorly. GRB10 maps to mouse chromosome 11, in close proximity to the EGF receptor. Similarly, GRB7 maps to the same mouse chromosome near the EGF receptor-related protein HER2.

Specifications

• Accession Number: Q13322
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2887
• Name: Human GRB10 (aa 437-515) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730571D09Rik; AI325020; Grb10; Grb-10; GRB10 adapter protein; GRB10 adaptor protein; GRBIR; GRB-IR; growth factor receptor bound protein 10; growth factor receptor-bound protein 10; Insulin receptor-binding protein Grb-IR; IRBP; KIAA0207; maternally expressed gene 1; maternally expressed gene 1 protein; Meg1; mKIAA0207; OTTHUMP00000197988; OTTHUMP00000197989; OTTHUMP00000197990; OTTHUMP00000197991; OTTHUMP00000197993; OTTHUMP00000197994; RGD1566234; RSS
• Common Name: GRB10
• Gene Symbol: GRB10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining