Invitrogen™ Human GSDMD (aa 154-252) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GSDMD (gasdermin-D) promotes pyroptosis in response to microbial infection and danger signals. It is produced by the cleavage of gasdermin-D by inflammatory caspases CASP1 or CASP4 in response to canonical, as well as, non-canonical (such as cytosolic LPS) inflammasome activators. After cleavage, GSDMD moves to the plasma membrane where it strongly binds to inner leaflet lipids including phosphatidylinositol 4-phosphate, phosphatidylinositol (4,5)-biphosphate, phosphatidylinositol (3,4,5)-biphosphate, phosphatidic acid, and phosphatidylserine. GSDMD also exhibits bactericidal activity.

Specifications

• Accession Number: P57764
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79792
• Name: Human GSDMD (aa 154-252) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810036L03Rik; AW558049; DF5L; Dfna5l; FKSG10; gasdermin D; gasdermin domain containing 1; gasdermin domain-containing protein 1; Gasdermin-D; Gasdermin-D, C-terminal; Gasdermin-D, N-terminal; GSDMD; GSDMDC1; GSDMD-CT; GSDMD-NT; M2-4
• Common Name: GSDMD
• Gene Symbol: GSDMD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining