Invitrogen™ Human GTPBP2 (aa 65-165) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56738 (PA5-56738. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Small G proteins act as molecular switches for regulation of variety of cellular processes, such as nuclear transport, signal transduction, membrane trafficking and protein synthesis. GTPBP2 (GTP-binding protein 2) is a 602 amino acid G protein that is expressed in kidney, skeletal muscle, testis, brain and thymus, though it is not detected in liver. Expression of GTPBP2 is enhanced by ©-interferon stimulation in HeLa cells, THP-1 cells and thioglycollate-elicited mouse peritoneal macrophages. There are four isoforms of GTPBP2 that are expressed as a result of alternative splicing events. Since mutation of the gene encoding GTPBP1 does not lead to any phenotypic abnormalities, it is thought that there may be a genetic redundancy to make up for GTPBP1 lack-of-function. GTPBP2 shares 44% sequence similarity with GTPBP1 and also overlaps in expression pattern, suggesting that the GTPBP2 gene may compensate for GTPBP1 genetic abnormalities.

Specifications

• Accession Number: Q9BX10
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54676
• Name: Human GTPBP2 (aa 65-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GTP binding protein 2; GTP-binding protein 2; GTP-binding-like protein 2; gtpbp2; I79_024595; nmf205
• Common Name: GTPBP2
• Gene Symbol: Gtpbp2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining