Abnova™ Human GULP1 Partial ORF (AAH01103, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00051454Q01

Catalog No. 89-946-882

Description

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.[supplied by OMIM]

Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISF

Specifications

• Accession Number: AAH01103
• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 36.63kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 2 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CED-6|CED6|FLJ31156|GULP
• Gene Symbol: GULP1
• Recombinant: Yes

• Expression System: wheat germ expression system
• Format: Liquid
• Gene ID (Entrez): 51454
• Name: GULP1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISF
• Regulatory Status: RUO
• Common Name: GULP1
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST