Abnova™ Human H2BFWT Partial ORF (NP_001002916.1, 31 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00158983Q01

Catalog No. 89-946-983

Description

Testis-specific histones, like H2BFWT, are synthesized and accumulate at specific stages of mammalian spermatogenesis. Their proposed functions range from facilitation of the replacement of somatic histones by protamines to epigenetic control of gene transcription (Churikov et al., 2004 [PubMed 15475252]).[supplied by OMIM]

Sequence: GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR

Specifications

• Accession Number: NP_001002916.1
• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 36.74kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 2 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: MGC148130|MGC148131
• Gene Symbol: H2BFWT
• Recombinant: Yes

• Expression System: wheat germ expression system
• Format: Liquid
• Gene ID (Entrez): 158983
• Name: H2BFWT (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: GPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKR
• Regulatory Status: RUO
• Common Name: H2BFWT
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST