Abnova™ Human HPS6 Partial ORF (NP_079023, 400 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Used for AP, Array, ELISA, WB-Re

This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq]

Sequence: KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG

Specifications

• Accession Number: NP_079023
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 79803
• Molecular Weight (g/mol): 36.85kDa
• Name: HPS6 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ22501/MGC20522/RP11-302K17.1
• Common Name: HPS6
• Gene Symbol: HPS6
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid