Invitrogen™ Human HTR3B (aa 339-411) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58838 (PA5-58838. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine, a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude.

Specifications

• Accession Number: O95264
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9177
• Name: Human HTR3B (aa 339-411) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5-HT3 receptor subunit B; 5-HT3B; 5-HT-3 B; 5-HT3-B; 5-HT3B receptor; 5-hydroxytryptamine (serotonin) receptor 3 B; 5-hydroxytryptamine (serotonin) receptor 3 B, ionotropic; 5-hydroxytryptamine 3 receptor B subunit; 5-hydroxytryptamine receptor 3 B; HTR3B; Serotonin receptor 3 B; serotonin-gated ion channel subunit
• Common Name: HTR3B
• Gene Symbol: HTR3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining