Invitrogen™ Human HUNK (aa 490-567) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HUNK serine/threonine kinase or hormonally up-regulated Neu-associated kinase is a member of the mitogen-activated protein kinase family which is essential for mammary tumor metastasis. HUNK deletion in mice did not alter viability, fertility, longevity, or propensity to develop tumors and it is also dispensable for murine development. HUNK has been shown to participate in vesicular transport. Additionally, functional studies in mice suggest that HUNK regulates endocytosis via interaction with rabaptin-5 protein and induces changes in mammary glands during pregnancy. HUNK expression has been documented in mouse brain, breast, embryo, and fetus. ESTs have been isolated from several human tissue libraries, including normal ear.

Specifications

• Accession Number: P57058
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 30811
• Name: Human HUNK (aa 490-567) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B19; Bstk1; Hormonally up-regulated neu tumor-associated kinase; hormonally upregulated neu tumor-associated kinase; hormonally up-regulated Neu-associated kinase; hormonally upregulated Neu-associated kinase; Hunk; MAKV; Mak-v; RGD1565091; serine/threonine protein kinase MAK-V; serine/threonine-protein kinase MAK-V
• Common Name: HUNK
• Gene Symbol: HUNK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining