Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95028

Invitrogen™ Human KATNA1 (aa 135-210) Control Fragment Recombinant Protein

Catalog No. RP95028
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57571 (PA5-57571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. This gene encodes the p80 subunit. This protein is a member of the AAA family of ATPases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75449
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11104
Name Human KATNA1 (aa 135-210) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HAMAP-Rule:MF_03023}; hypothetical protein LOC553631; katanin catalytic subunit A1; katanin p60 (ATPase containing) subunit A 1; katanin p60 (ATPase-containing) subunit A 1; katanin p60 (ATPase-containing) subunit A1; katanin p60 ATPase-containing subunit A1; katanin p60 ATPase-containing subunit A1 {ECO:0000255; Katanin p60 ATPase-containing subunit A1-like protein; katanin p60 subunit A 1; katanin p60 subunit A1; katanin p60 subunit A1 {ECO:0000255; KATNA1; lipotransin; microtubule severing protein; p60 katanin; p60 katanin {ECO:0000255; si:dkey-15j16.1; zgc:110580
Common Name KATNA1
Gene Symbol KATNA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.