Learn More
Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
Supplier: Abnova™ H00003810P01S
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVT
Specifications
AAI60061.1 | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
KIR2DS5 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA | |
RUO | |
KIR2DS5 | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
3810 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CD158G/NKAT9 | |
KIR2DS5 | |
Liquid |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
For Research Use Only