Invitrogen™ Human LPHN1 (aa 1182-1243) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58189 (PA5-58189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adgrl1 (Latrophilin-1) is a calcium-independent receptor of high affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Adgrl1 is a receptor for TENM2 that mediates heterophilic synaptic cell-cell contact and postsynaptic specialization, and may be implicated in the regulation of exocytosis. The Adgrl1 gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Adgrl1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms of Adgrl1. Diseases associated with ADGRL1 include Dermatophytosis and Retinal Degeneration, Late-Onset, Autosomal Dominant.

Specifications

• Accession Number: O94910
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22859
• Name: Human LPHN1 (aa 1182-1243) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900070I05Rik; ADGRL1; Adhesion G protein-coupled receptor L1; AI182398; calcium-independent alpha-latrotoxin receptor 1; Cirl; Cirl1; CIRL-1; CL1; CL1BA; CLIBA; KIAA0821; latrophilin 1; latrophilin-1; LEC2; Lectomedin-2; Lphh2; LPHN1; mKIAA0821
• Common Name: LPHN1
• Gene Symbol: Adgrl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining