Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LRRC59 (aa 266-307) Control Fragment Recombinant Protein

Catalog No. RP95601
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83160 (PA5-83160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear pores. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96AG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55379
Name Human LRRC59 (aa 266-307) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA959742; C78668; hypothetical protein PRO1855; leucine rich repeat containing 59; leucine-rich repeat-containing protein 59; Leucine-rich repeat-containing protein 59, N-terminally processed; leucine-rich repeat-containing protein 59; LOW QUALITY PROTEIN: leucine-rich repeat-containing protein 59; LRRC59; p34; PRO1855; Protein p34; Rbp34; Ribosome-binding protein p34
Common Name LRRC59
Gene Symbol Lrrc59
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.