Invitrogen™ Human MEK1 (aa 1-58) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP2K1 (MEK1) kinase is a dual-specificity protein kinase that functions in mitogen-activated protein kinase (MAPK) cascades, controlling cell growth and differentiation. MAP2K1 is activated by a wide variety of growth factors and cytokines and also by membrane-dependent depolarization and calcium influx. Mek1 is activated by phosphorylation of serine 218 and 222 residues by Raf1. It is known to be involved in the signaling during stress activate response, apoptosis and proliferative induction by cytokines. Mutations in the gene can lead to cardiofaciocutaneous syndrome.

Specifications

• Accession Number: Q02750
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5604
• Name: Human MEK1 (aa 1-58) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CFC3; dual specificity mitogen activated protein kinase kinase 1; dual specificity mitogen-activated protein kinase kinase 1; EC 2.7.12.2; ERK activator kinase 1; kinase MEK1; MAP kinase kinase 1; MAP kinase kinase or Erk Kinase, Dual specificity mitogen-activated protein kinase kinase, involved in ras mediated vulval induction, LEThal LET-537 (42.8 kD) (mek-2); MAP kinase/Erk kinase 1; Map2k1; map2k1.L; MAPK/ERK kinase 1; MAPKK 1; MAPKK1; MEK 1; Mek1; MEK2; mek-2; MEKK1; mitogen activated protein kinase kinase 1; mitogen-activated protein kinase kinase 1; mitogen-activated protein kinase kinase 1 L homeolog; MKK (Thr292); MKK (Thr386); MKK1; MKK2; MP2K1; Prkmk1; PRKMK2; protein kinase, mitogen activated, kinase 1, p45; protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1); XELAEV_18018447mg
• Common Name: MEK1
• Gene Symbol: Map2k1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining