Invitrogen™ Human MRGPRF Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110966 (PA5-110966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain. Expressed in the Gut, vas deferens, uterus and aorta; barely detectable in liver, kidney, lung, and salivary gland. In the brain, markedly abundant in the cerebellum.

Specifications

• Accession Number: Q96AM1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116535
• Name: Human MRGPRF Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC019711; G protein coupled receptor (RTA); G protein coupled receptor Rca; G protein-coupled receptor 140; G protein-coupled receptor 168; G protein-coupled receptor MrgF; G protein-coupled receptor RTA; G-p; GPR140; GPR168; G-protein coupled receptor 140; G-protein coupled receptor 168; G-protein coupled receptor RTA; MAS related GPR family member F; mas-related G protein-coupled MRGF; Mas-related G protein-coupled receptor c; mas-related gene; mas-related gene F protein; MAS-related GPR, member F; mas-related G-protein coupled receptor member F; MAS-related G-protein coupled receptor, member F; MGC21621; Mgrc; MRGF; MRGPRF; PSEC0142; Rta; seven transmembrane helix receptor
• Common Name: MRGPRF
• Gene Symbol: MRGPRF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining