Invitrogen™ Human MXI1 (aa 103-158) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57225 (PA5-57225. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

It is now well established that Myc regulation of cell proliferation and differentiation involves a family of related transcription factors. One such factor, Max, is an obligate heterodimeric partner for Myc and can also form heterodimers with at least four related proteins designated Mad 1, Mxi1, Mad 3 and Mad 4. Like Mad 1 and Mxi1, association of Mad 3 and Mad 4 with Max results in transcriptional repression. Both Myc and the Mad proteins have short half-lives and their synthesis is tightly regulated, while Max expression is constitutive and relatively stable. Two related mammalian cDNAs have been identified and shown to encode Mad-binding proteins. Both possess sequence homology with the yeast transcription repressor Sin3 including four conserved paired amphipathic helix (PAH) domains. mSin3A and mSin3B specifically interact with the Mad proteins via their second paired amphipathic helix domain (PAH2). It has been suggested that Mad-Max heterodimers repress transcription by tethering mSin3 to DNA as corepressors.

Specifications

• Accession Number: P50539
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4601
• Name: Human MXI1 (aa 103-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bHLHc11; class C basic helix-loop-helix protein 11; ENSMUSG00000067085; Gm10197; Mad2; MAX dimerization protein 2; Max interacting protein 1; MAX interactor 1; MAX interactor 1, dimerization protein; max-interacting protein 1; Max-interacting protein 1-like protein; Max-related transcription factor; MGC43220; MXD2; MXI; MXI1; MXI-WR; RP11-549L6.1
• Common Name: MXI1
• Gene Symbol: Mxi1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining