Invitrogen™ Human NALCN (aa 1628-1721) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56888 (PA5-56888. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nalcn is a voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Nalcn regulates the resting membrane potential and controls neuronal excitability (PubMed:17448995). Neuropeptides such as neurotensin and substance P (SP) stimulate the firing of action potentials by activating NALCN through a SRC family kinases-dependent pathway. In addition to its baseline activity, Nalcn activity is enhanced/modulated by several GPCRs, is required for normal respiratory rhythm and neonatal survival, is involved in systemic osmoregulation by controlling the serum sodium concentration. Nalcn is partly responsible for the substance P-induced depolarization and regulation of the intestinal pace-making activity in the interstitial cells of Cajal. Further, Nalcn plays a critical role in both maintenance of spontaneous firing of substantia nigra pars reticulata (SNr) neurons and physiological modulation of SNr neuron excitability. Diseases associated with NALCN include Congenital contractures of the limbs and face, Hypotonia, Developmental Delay and Hypotonia, Infantile Psychomotor Retardation And Characteristic Facies 1.

Specifications

• Accession Number: Q8IZF0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 259232
• Name: Human NALCN (aa 1628-1721) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A530023G15Rik; AI849508; bA430M15.1; brain voltage-gated cation channel; CanIon; CLIFAHDD; FLJ23913; FLJ44659; FLJ44764; Four domain-type voltage-gated ion channel alpha-1 subunit; four repeat voltage-gated ion channel; IHPRF; IHPRF1; INNFD; MGC74524; Nalcn; Nca; Rb21; Rb21-channel; Sodium leak channel non-selective protein; sodium leak channel, non selective; sodium leak channel, non-selective; Vgcnl1; voltage gated channel like 1; voltage gated channel-like protein 1
• Common Name: NALCN
• Gene Symbol: NALCN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining